CDK1 anticorps (Middle Region)

N° du produit ABIN634188

Cet anticorps anti-CDK1 est un anticorps Lapin Polyclonal détectant CDK1 dans WB. Adapté pour Humain, Souris, Rat, Drosophila melanogaster et Arabidopsis.

Aperçu rapide pour CDK1 anticorps (Middle Region) (ABIN634188)

Antigène: CDK1 (Cyclin-Dependent Kinase 1 (CDK1))

Reactivité: Humain, Souris, Rat, Drosophila melanogaster, Arabidopsis

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDK1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CDK1 anticorps

Épitope: Middle Region

Specificité: CDC2 antibody was raised against the middle region of CDC2

Purification: Affinity purified

Immunogène: CDC2 antibody was raised using the middle region of CDC2 corresponding to a region with amino acids CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDC2 Blocking Peptide, (ABIN937029), is also available for use as a blocking control in assays to test for specificity of this CDC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDK1

Antigène: CDK1 (Cyclin-Dependent Kinase 1 (CDK1))

Autre désignation: CDC2

Sujet: The protein encoded by CDC2 is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Cycle Cellulaire, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Activation of Innate immune Response, Mitotic G1-G1/S Phases, DNA Replication, M Phase, Toll-Like Receptors Cascades, Synthesis of DNA